Placeholder image of a protein
Icon representing a puzzle

1471: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since about 8 years ago

Intermediate Overall Prediction

Summary


Created
January 16, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups


  1. Avatar for Deleted group 21. Deleted group pts. 8,792
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 8,695
  3. Avatar for Trinity Biology 23. Trinity Biology 1 pt. 8,338

  1. Avatar for Flagg65a 31. Flagg65a Lv 1 37 pts. 9,933
  2. Avatar for pvc78 32. pvc78 Lv 1 35 pts. 9,926
  3. Avatar for Deleted player 33. Deleted player pts. 9,925
  4. Avatar for bertro 34. bertro Lv 1 33 pts. 9,915
  5. Avatar for Azukay 35. Azukay Lv 1 32 pts. 9,894
  6. Avatar for Tehnologik1 36. Tehnologik1 Lv 1 30 pts. 9,893
  7. Avatar for fpc 37. fpc Lv 1 29 pts. 9,893
  8. Avatar for gmn 38. gmn Lv 1 28 pts. 9,892
  9. Avatar for eromana 39. eromana Lv 1 27 pts. 9,891
  10. Avatar for Museka 40. Museka Lv 1 26 pts. 9,888

Comments