Placeholder image of a protein
Icon representing a puzzle

1471: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since over 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 16, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups


  1. Avatar for Beta Folders 100 pts. 10,205
  2. Avatar for Gargleblasters 2. Gargleblasters 80 pts. 10,137
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 63 pts. 10,110
  4. Avatar for Go Science 4. Go Science 49 pts. 10,094
  5. Avatar for HMT heritage 5. HMT heritage 37 pts. 10,037
  6. Avatar for Contenders 6. Contenders 28 pts. 10,022
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 21 pts. 9,979
  8. Avatar for Void Crushers 8. Void Crushers 15 pts. 9,941
  9. Avatar for Marvin's bunch 9. Marvin's bunch 11 pts. 9,937
  10. Avatar for GENE 433 10. GENE 433 8 pts. 9,816

  1. Avatar for Flagg65a 31. Flagg65a Lv 1 37 pts. 9,933
  2. Avatar for pvc78 32. pvc78 Lv 1 35 pts. 9,926
  3. Avatar for Deleted player 33. Deleted player pts. 9,925
  4. Avatar for bertro 34. bertro Lv 1 33 pts. 9,915
  5. Avatar for Azukay 35. Azukay Lv 1 32 pts. 9,894
  6. Avatar for Tehnologik1 36. Tehnologik1 Lv 1 30 pts. 9,893
  7. Avatar for fpc 37. fpc Lv 1 29 pts. 9,893
  8. Avatar for gmn 38. gmn Lv 1 28 pts. 9,892
  9. Avatar for eromana 39. eromana Lv 1 27 pts. 9,891
  10. Avatar for Museka 40. Museka Lv 1 26 pts. 9,888

Comments