Placeholder image of a protein
Icon representing a puzzle

1471: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
January 16, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,205
  2. Avatar for Gargleblasters 2. Gargleblasters 80 pts. 10,137
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 63 pts. 10,110
  4. Avatar for Go Science 4. Go Science 49 pts. 10,094
  5. Avatar for HMT heritage 5. HMT heritage 37 pts. 10,037
  6. Avatar for Contenders 6. Contenders 28 pts. 10,022
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 21 pts. 9,979
  8. Avatar for Void Crushers 8. Void Crushers 15 pts. 9,941
  9. Avatar for Marvin's bunch 9. Marvin's bunch 11 pts. 9,937
  10. Avatar for GENE 433 10. GENE 433 8 pts. 9,816
  1. Avatar for multaq 111. multaq Lv 1 1 pt. 9,511
  2. Avatar for Mike Cassidy 112. Mike Cassidy Lv 1 1 pt. 9,508
  3. Avatar for Satina 113. Satina Lv 1 1 pt. 9,506
  4. Avatar for Savas 114. Savas Lv 1 1 pt. 9,500
  5. Avatar for xabxs 115. xabxs Lv 1 1 pt. 9,491
  6. Avatar for bzipitidoo 116. bzipitidoo Lv 1 1 pt. 9,491
  7. Avatar for hanyanbo98 117. hanyanbo98 Lv 1 1 pt. 9,485
  8. Avatar for NotJim99 118. NotJim99 Lv 1 1 pt. 9,484
  9. Avatar for Auntecedent 119. Auntecedent Lv 1 1 pt. 9,482
  10. Avatar for Noodle Soup 120. Noodle Soup Lv 1 1 pt. 9,470

Comments