Placeholder image of a protein
Icon representing a puzzle

1474: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
January 24, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups

  1. Avatar for Richard Dawkins Foundation 11. Richard Dawkins Foundation 1 pt. 8,944
  2. Avatar for LEC Metabolites 12. LEC Metabolites 1 pt. 8,620
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,482
  4. Avatar for JCBio162 14. JCBio162 1 pt. 7,667
  5. Avatar for UBCO-BIOC402-2018WT2 15. UBCO-BIOC402-2018WT2 1 pt. 7,544
  6. Avatar for OmHS 16. OmHS 1 pt. 7,544
  1. Avatar for lamoille 131. lamoille Lv 1 1 pt. 8,633
  2. Avatar for Anamfija 132. Anamfija Lv 1 1 pt. 8,629
  3. Avatar for jtedescolec 133. jtedescolec Lv 1 1 pt. 8,620
  4. Avatar for NotJim99 134. NotJim99 Lv 1 1 pt. 8,616
  5. Avatar for MegynC 135. MegynC Lv 1 1 pt. 8,615
  6. Avatar for Jacksonfly 136. Jacksonfly Lv 1 1 pt. 8,600
  7. Avatar for t012 137. t012 Lv 1 1 pt. 8,567
  8. Avatar for The_mad_coder 138. The_mad_coder Lv 1 1 pt. 8,540
  9. Avatar for larry25427 139. larry25427 Lv 1 1 pt. 8,514
  10. Avatar for iON_Q 140. iON_Q Lv 1 1 pt. 8,488

Comments