Placeholder image of a protein
Icon representing a puzzle

1474: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
January 24, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups

  1. Avatar for Richard Dawkins Foundation 11. Richard Dawkins Foundation 1 pt. 8,944
  2. Avatar for LEC Metabolites 12. LEC Metabolites 1 pt. 8,620
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,482
  4. Avatar for JCBio162 14. JCBio162 1 pt. 7,667
  5. Avatar for UBCO-BIOC402-2018WT2 15. UBCO-BIOC402-2018WT2 1 pt. 7,544
  6. Avatar for OmHS 16. OmHS 1 pt. 7,544
  1. Avatar for johnmitch 11. johnmitch Lv 1 74 pts. 9,617
  2. Avatar for Skippysk8s 12. Skippysk8s Lv 1 71 pts. 9,615
  3. Avatar for Timo van der Laan 13. Timo van der Laan Lv 1 69 pts. 9,610
  4. Avatar for grogar7 14. grogar7 Lv 1 67 pts. 9,608
  5. Avatar for caglar 15. caglar Lv 1 65 pts. 9,596
  6. Avatar for christioanchauvin 16. christioanchauvin Lv 1 63 pts. 9,592
  7. Avatar for crpainter 17. crpainter Lv 1 61 pts. 9,592
  8. Avatar for nicobul 18. nicobul Lv 1 59 pts. 9,592
  9. Avatar for Threeoak 19. Threeoak Lv 1 57 pts. 9,582
  10. Avatar for pvc78 20. pvc78 Lv 1 55 pts. 9,567

Comments