1474: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since about 8 years ago

Summary

• Created: January 24, 2018
• Expires: January 31, 2018 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups

• 1. Beta Folders 100 pts. 9,773
• 2. Contenders 71 pts. 9,692
• 3. Gargleblasters 49 pts. 9,691
• 4. Go Science 33 pts. 9,668
• 5. Marvin's bunch 22 pts. 9,668
• 6. Anthropic Dreams 14 pts. 9,629
• 7. Void Crushers 8 pts. 9,610
• 8. L'Alliance Francophone 5 pts. 9,592
• 9. HMT heritage 3 pts. 9,384
• 10. GENE 433 2 pts. 9,119

Top soloists

• 11. johnmitch 74 pts. 9,617
• 12. Skippysk8s 71 pts. 9,615
• 13. Timo van der Laan 69 pts. 9,610
• 14. grogar7 67 pts. 9,608
• 15. caglar 65 pts. 9,596
• 16. christioanchauvin 63 pts. 9,592
• 17. crpainter 61 pts. 9,592
• 18. nicobul 59 pts. 9,592
• 19. Threeoak 57 pts. 9,582
• 20. pvc78 55 pts. 9,567