Placeholder image of a protein
Icon representing a puzzle

1474: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
January 24, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups

  1. Avatar for Richard Dawkins Foundation 11. Richard Dawkins Foundation 1 pt. 8,944
  2. Avatar for LEC Metabolites 12. LEC Metabolites 1 pt. 8,620
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,482
  4. Avatar for JCBio162 14. JCBio162 1 pt. 7,667
  5. Avatar for UBCO-BIOC402-2018WT2 15. UBCO-BIOC402-2018WT2 1 pt. 7,544
  6. Avatar for OmHS 16. OmHS 1 pt. 7,544
  1. Avatar for toshiue 21. toshiue Lv 1 53 pts. 9,559
  2. Avatar for dcrwheeler 22. dcrwheeler Lv 1 51 pts. 9,557
  3. Avatar for gmn 23. gmn Lv 1 50 pts. 9,546
  4. Avatar for Sissue 24. Sissue Lv 1 48 pts. 9,545
  5. Avatar for pauldunn 25. pauldunn Lv 1 46 pts. 9,540
  6. Avatar for NinjaGreg 26. NinjaGreg Lv 1 45 pts. 9,535
  7. Avatar for fiendish_ghoul 27. fiendish_ghoul Lv 1 43 pts. 9,512
  8. Avatar for Blipperman 28. Blipperman Lv 1 42 pts. 9,499
  9. Avatar for Deleted player 29. Deleted player pts. 9,489
  10. Avatar for actiasluna 30. actiasluna Lv 1 39 pts. 9,488

Comments