Placeholder image of a protein
Icon representing a puzzle

1474: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
January 24, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,773
  2. Avatar for Contenders 2. Contenders 71 pts. 9,692
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 9,691
  4. Avatar for Go Science 4. Go Science 33 pts. 9,668
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 9,668
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 14 pts. 9,629
  7. Avatar for Void Crushers 7. Void Crushers 8 pts. 9,610
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 5 pts. 9,592
  9. Avatar for HMT heritage 9. HMT heritage 3 pts. 9,384
  10. Avatar for GENE 433 10. GENE 433 2 pts. 9,119
  1. Avatar for toshiue 21. toshiue Lv 1 53 pts. 9,559
  2. Avatar for dcrwheeler 22. dcrwheeler Lv 1 51 pts. 9,557
  3. Avatar for gmn 23. gmn Lv 1 50 pts. 9,546
  4. Avatar for Sissue 24. Sissue Lv 1 48 pts. 9,545
  5. Avatar for pauldunn 25. pauldunn Lv 1 46 pts. 9,540
  6. Avatar for NinjaGreg 26. NinjaGreg Lv 1 45 pts. 9,535
  7. Avatar for fiendish_ghoul 27. fiendish_ghoul Lv 1 43 pts. 9,512
  8. Avatar for Blipperman 28. Blipperman Lv 1 42 pts. 9,499
  9. Avatar for Deleted player 29. Deleted player pts. 9,489
  10. Avatar for actiasluna 30. actiasluna Lv 1 39 pts. 9,488

Comments