Placeholder image of a protein
Icon representing a puzzle

1474: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since about 8 years ago

Intermediate Overall Prediction

Summary


Created
January 24, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups


  1. Avatar for LEC Metabolites 12. LEC Metabolites 1 pt. 8,620
  2. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,482
  3. Avatar for JCBio162 14. JCBio162 1 pt. 7,667
  4. Avatar for UBCO-BIOC402-2018WT2 15. UBCO-BIOC402-2018WT2 1 pt. 7,544
  5. Avatar for OmHS 16. OmHS 1 pt. 7,544

  1. Avatar for Idiotboy 41. Idiotboy Lv 1 26 pts. 9,354
  2. Avatar for alwen 42. alwen Lv 1 25 pts. 9,353
  3. Avatar for jobo0502 43. jobo0502 Lv 1 24 pts. 9,352
  4. Avatar for dizzywings 44. dizzywings Lv 1 23 pts. 9,349
  5. Avatar for dbuske 45. dbuske Lv 1 22 pts. 9,347
  6. Avatar for WBarme1234 46. WBarme1234 Lv 1 21 pts. 9,340
  7. Avatar for fishercat 47. fishercat Lv 1 20 pts. 9,319
  8. Avatar for altejoh 48. altejoh Lv 1 19 pts. 9,312
  9. Avatar for Museka 49. Museka Lv 1 19 pts. 9,311
  10. Avatar for Flagg65a 50. Flagg65a Lv 1 18 pts. 9,307

Comments