Placeholder image of a protein
Icon representing a puzzle

1474: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since over 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 24, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups


  1. Avatar for Beta Folders 100 pts. 9,773
  2. Avatar for Contenders 2. Contenders 71 pts. 9,692
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 9,691
  4. Avatar for Go Science 4. Go Science 33 pts. 9,668
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 9,668
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 14 pts. 9,629
  7. Avatar for Void Crushers 7. Void Crushers 8 pts. 9,610
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 5 pts. 9,592
  9. Avatar for HMT heritage 9. HMT heritage 3 pts. 9,384
  10. Avatar for GENE 433 10. GENE 433 2 pts. 9,119

  1. Avatar for Idiotboy 41. Idiotboy Lv 1 26 pts. 9,354
  2. Avatar for alwen 42. alwen Lv 1 25 pts. 9,353
  3. Avatar for jobo0502 43. jobo0502 Lv 1 24 pts. 9,352
  4. Avatar for dizzywings 44. dizzywings Lv 1 23 pts. 9,349
  5. Avatar for dbuske 45. dbuske Lv 1 22 pts. 9,347
  6. Avatar for WBarme1234 46. WBarme1234 Lv 1 21 pts. 9,340
  7. Avatar for fishercat 47. fishercat Lv 1 20 pts. 9,319
  8. Avatar for altejoh 48. altejoh Lv 1 19 pts. 9,312
  9. Avatar for Museka 49. Museka Lv 1 19 pts. 9,311
  10. Avatar for Flagg65a 50. Flagg65a Lv 1 18 pts. 9,307

Comments