1483: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since about 8 years ago

Summary

• Created: February 14, 2018
• Expires: February 21, 2018 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups

• 1. Beta Folders 100 pts. 10,116
• 2. Gargleblasters 65 pts. 9,954
• 3. Go Science 41 pts. 9,944
• 4. Void Crushers 24 pts. 9,932
• 5. Anthropic Dreams 14 pts. 9,927
• 6. Marvin's bunch 7 pts. 9,839
• 7. L'Alliance Francophone 4 pts. 9,823
• 8. Contenders 2 pts. 9,762
• 9. Russian team 1 pt. 9,402
• 10. freefolder 1 pt. 9,048

Top soloists

• 11. retiredmichael 72 pts. 9,889
• 12. Galaxie 69 pts. 9,884
• 13. dcrwheeler 67 pts. 9,874
• 14. drjr 64 pts. 9,860
• 15. Skippysk8s 62 pts. 9,856
• 16. bertro 60 pts. 9,854
• 17. frood66 58 pts. 9,839
• 18. Blipperman 56 pts. 9,825
• 19. nicobul 54 pts. 9,823
• 20. johnmitch 52 pts. 9,811