Placeholder image of a protein
Icon representing a puzzle

1483: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 14, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,116
  2. Avatar for Gargleblasters 2. Gargleblasters 65 pts. 9,954
  3. Avatar for Go Science 3. Go Science 41 pts. 9,944
  4. Avatar for Void Crushers 4. Void Crushers 24 pts. 9,932
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 14 pts. 9,927
  6. Avatar for Marvin's bunch 6. Marvin's bunch 7 pts. 9,839
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 4 pts. 9,823
  8. Avatar for Contenders 8. Contenders 2 pts. 9,762
  9. Avatar for Russian team 9. Russian team 1 pt. 9,402
  10. Avatar for freefolder 10. freefolder 1 pt. 9,048
  1. Avatar for petetrig 141. petetrig Lv 1 1 pt. 8,474
  2. Avatar for 01010011111 142. 01010011111 Lv 1 1 pt. 8,382
  3. Avatar for gualad 143. gualad Lv 1 1 pt. 8,271
  4. Avatar for Aragost 144. Aragost Lv 1 1 pt. 8,195
  5. Avatar for Horn_6 145. Horn_6 Lv 1 1 pt. 8,131
  6. Avatar for mkbboy35 146. mkbboy35 Lv 1 1 pt. 8,070
  7. Avatar for Hollinas 147. Hollinas Lv 1 1 pt. 7,869
  8. Avatar for puxatudo 148. puxatudo Lv 1 1 pt. 7,869
  9. Avatar for emtonsti 149. emtonsti Lv 1 1 pt. 7,869
  10. Avatar for reefyrob 150. reefyrob Lv 1 1 pt. 7,869

Comments