Placeholder image of a protein
Icon representing a puzzle

1483: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 14, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,116
  2. Avatar for Gargleblasters 2. Gargleblasters 65 pts. 9,954
  3. Avatar for Go Science 3. Go Science 41 pts. 9,944
  4. Avatar for Void Crushers 4. Void Crushers 24 pts. 9,932
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 14 pts. 9,927
  6. Avatar for Marvin's bunch 6. Marvin's bunch 7 pts. 9,839
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 4 pts. 9,823
  8. Avatar for Contenders 8. Contenders 2 pts. 9,762
  9. Avatar for Russian team 9. Russian team 1 pt. 9,402
  10. Avatar for freefolder 10. freefolder 1 pt. 9,048
  1. Avatar for Datstandin 121. Datstandin Lv 1 1 pt. 8,908
  2. Avatar for Anamfija 122. Anamfija Lv 1 1 pt. 8,901
  3. Avatar for spracked 123. spracked Lv 1 1 pt. 8,897
  4. Avatar for aspadistra 124. aspadistra Lv 1 1 pt. 8,864
  5. Avatar for sampsokc 125. sampsokc Lv 1 1 pt. 8,847
  6. Avatar for bzipitidoo 126. bzipitidoo Lv 1 1 pt. 8,842
  7. Avatar for SaraL 127. SaraL Lv 1 1 pt. 8,821
  8. Avatar for DanyT 128. DanyT Lv 1 1 pt. 8,800
  9. Avatar for HL3 129. HL3 Lv 1 1 pt. 8,797
  10. Avatar for C o n s u m e 130. C o n s u m e Lv 1 1 pt. 8,791

Comments