Placeholder image of a protein
Icon representing a puzzle

1483: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 14, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,116
  2. Avatar for Gargleblasters 2. Gargleblasters 65 pts. 9,954
  3. Avatar for Go Science 3. Go Science 41 pts. 9,944
  4. Avatar for Void Crushers 4. Void Crushers 24 pts. 9,932
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 14 pts. 9,927
  6. Avatar for Marvin's bunch 6. Marvin's bunch 7 pts. 9,839
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 4 pts. 9,823
  8. Avatar for Contenders 8. Contenders 2 pts. 9,762
  9. Avatar for Russian team 9. Russian team 1 pt. 9,402
  10. Avatar for freefolder 10. freefolder 1 pt. 9,048
  1. Avatar for dizzywings 51. dizzywings Lv 1 14 pts. 9,519
  2. Avatar for guineapig 52. guineapig Lv 1 13 pts. 9,509
  3. Avatar for DoctorSockrates 53. DoctorSockrates Lv 1 13 pts. 9,507
  4. Avatar for ViJay7019 54. ViJay7019 Lv 1 12 pts. 9,495
  5. Avatar for Glen B 55. Glen B Lv 1 12 pts. 9,492
  6. Avatar for bcre8tvv 56. bcre8tvv Lv 1 11 pts. 9,470
  7. Avatar for tarimo 57. tarimo Lv 1 11 pts. 9,461
  8. Avatar for dbuske 58. dbuske Lv 1 10 pts. 9,439
  9. Avatar for jamiexq 59. jamiexq Lv 1 10 pts. 9,437
  10. Avatar for alcor29 60. alcor29 Lv 1 9 pts. 9,432

Comments