Placeholder image of a protein
Icon representing a puzzle

1484: Unsolved De-novo Freestyle 126

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 15, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ETRIELRDDNGRYEIHVDDNGDRIEINIDNGDVQIRSHDSNEDRQRKIEEFLRRQDTHLEEMVRRLLKELEKESK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,573
  2. Avatar for Gargleblasters 2. Gargleblasters 65 pts. 9,525
  3. Avatar for Go Science 3. Go Science 41 pts. 9,509
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 24 pts. 9,465
  5. Avatar for Marvin's bunch 5. Marvin's bunch 14 pts. 9,438
  6. Avatar for Contenders 6. Contenders 7 pts. 9,344
  7. Avatar for Void Crushers 7. Void Crushers 4 pts. 9,308
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 2 pts. 9,269
  9. Avatar for Russian team 9. Russian team 1 pt. 9,231
  10. Avatar for freefolder 10. freefolder 1 pt. 8,956
  1. Avatar for Elektron72 101. Elektron72 Lv 1 1 pt. 8,439
  2. Avatar for Flagg65a 102. Flagg65a Lv 1 1 pt. 8,399
  3. Avatar for Vincera 103. Vincera Lv 1 1 pt. 8,357
  4. Avatar for bcre8tvv 104. bcre8tvv Lv 1 1 pt. 8,319
  5. Avatar for toshiue 105. toshiue Lv 1 1 pt. 8,319
  6. Avatar for dbuske 106. dbuske Lv 1 1 pt. 8,292
  7. Avatar for momadoc 107. momadoc Lv 1 1 pt. 8,291
  8. Avatar for hada 108. hada Lv 1 1 pt. 8,276
  9. Avatar for xabxs 109. xabxs Lv 1 1 pt. 8,225
  10. Avatar for abiogenesis 110. abiogenesis Lv 1 1 pt. 8,133

Comments