Placeholder image of a protein
Icon representing a puzzle

1484: Unsolved De-novo Freestyle 126

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 15, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ETRIELRDDNGRYEIHVDDNGDRIEINIDNGDVQIRSHDSNEDRQRKIEEFLRRQDTHLEEMVRRLLKELEKESK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,573
  2. Avatar for Gargleblasters 2. Gargleblasters 65 pts. 9,525
  3. Avatar for Go Science 3. Go Science 41 pts. 9,509
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 24 pts. 9,465
  5. Avatar for Marvin's bunch 5. Marvin's bunch 14 pts. 9,438
  6. Avatar for Contenders 6. Contenders 7 pts. 9,344
  7. Avatar for Void Crushers 7. Void Crushers 4 pts. 9,308
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 2 pts. 9,269
  9. Avatar for Russian team 9. Russian team 1 pt. 9,231
  10. Avatar for freefolder 10. freefolder 1 pt. 8,956
  1. Avatar for tokens 11. tokens Lv 1 73 pts. 9,410
  2. Avatar for Enzyme 12. Enzyme Lv 1 70 pts. 9,397
  3. Avatar for LociOiling 13. LociOiling Lv 1 68 pts. 9,397
  4. Avatar for pauldunn 14. pauldunn Lv 1 66 pts. 9,371
  5. Avatar for Deleted player 15. Deleted player pts. 9,361
  6. Avatar for Skippysk8s 16. Skippysk8s Lv 1 61 pts. 9,356
  7. Avatar for Bletchley Park 17. Bletchley Park Lv 1 59 pts. 9,344
  8. Avatar for dcrwheeler 18. dcrwheeler Lv 1 57 pts. 9,340
  9. Avatar for guineapig 19. guineapig Lv 1 55 pts. 9,336
  10. Avatar for reefyrob 20. reefyrob Lv 1 53 pts. 9,320

Comments