Placeholder image of a protein
Icon representing a puzzle

1484: Unsolved De-novo Freestyle 126

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 15, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ETRIELRDDNGRYEIHVDDNGDRIEINIDNGDVQIRSHDSNEDRQRKIEEFLRRQDTHLEEMVRRLLKELEKESK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,573
  2. Avatar for Gargleblasters 2. Gargleblasters 65 pts. 9,525
  3. Avatar for Go Science 3. Go Science 41 pts. 9,509
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 24 pts. 9,465
  5. Avatar for Marvin's bunch 5. Marvin's bunch 14 pts. 9,438
  6. Avatar for Contenders 6. Contenders 7 pts. 9,344
  7. Avatar for Void Crushers 7. Void Crushers 4 pts. 9,308
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 2 pts. 9,269
  9. Avatar for Russian team 9. Russian team 1 pt. 9,231
  10. Avatar for freefolder 10. freefolder 1 pt. 8,956
  1. Avatar for arcsign 21. arcsign Lv 1 51 pts. 9,314
  2. Avatar for Mike Cassidy 22. Mike Cassidy Lv 1 50 pts. 9,308
  3. Avatar for phi16 23. phi16 Lv 1 48 pts. 9,305
  4. Avatar for diamonddays 24. diamonddays Lv 1 46 pts. 9,301
  5. Avatar for Deleted player 25. Deleted player pts. 9,294
  6. Avatar for Fat Tony 26. Fat Tony Lv 1 43 pts. 9,282
  7. Avatar for Timo van der Laan 27. Timo van der Laan Lv 1 41 pts. 9,278
  8. Avatar for Vinara 28. Vinara Lv 1 40 pts. 9,276
  9. Avatar for pvc78 29. pvc78 Lv 1 38 pts. 9,272
  10. Avatar for christioanchauvin 30. christioanchauvin Lv 1 37 pts. 9,269

Comments