Placeholder image of a protein
Icon representing a puzzle

1486: Revisiting Puzzle 165: Rosetta Model 15

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 20, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The starting structure is a Rosetta model. This protein contains four cysteine residues, but only two of them oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 9,254
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 9,094
  3. Avatar for Czech National Team 13. Czech National Team 1 pt. 9,048
  4. Avatar for Richard Dawkins Foundation 14. Richard Dawkins Foundation 1 pt. 9,030
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,990
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 8,833
  1. Avatar for rabamino12358 91. rabamino12358 Lv 1 1 pt. 9,254
  2. Avatar for Altercomp 92. Altercomp Lv 1 1 pt. 9,254
  3. Avatar for tokens 93. tokens Lv 1 1 pt. 9,250
  4. Avatar for rezaefar 94. rezaefar Lv 1 1 pt. 9,241
  5. Avatar for Vincera 95. Vincera Lv 1 1 pt. 9,239
  6. Avatar for senor pit 96. senor pit Lv 1 1 pt. 9,234
  7. Avatar for andrewxc 97. andrewxc Lv 1 1 pt. 9,233
  8. Avatar for Flagg65a 98. Flagg65a Lv 1 1 pt. 9,219
  9. Avatar for martinf 99. martinf Lv 1 1 pt. 9,213
  10. Avatar for Auntecedent 100. Auntecedent Lv 1 1 pt. 9,208

Comments