Placeholder image of a protein
Icon representing a puzzle

1486: Revisiting Puzzle 165: Rosetta Model 15

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 20, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The starting structure is a Rosetta model. This protein contains four cysteine residues, but only two of them oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,202
  2. Avatar for Go Science 2. Go Science 71 pts. 10,115
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 10,077
  4. Avatar for Marvin's bunch 4. Marvin's bunch 33 pts. 10,015
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 9,953
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 14 pts. 9,949
  7. Avatar for HMT heritage 7. HMT heritage 8 pts. 9,872
  8. Avatar for Contenders 8. Contenders 5 pts. 9,796
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 3 pts. 9,795
  10. Avatar for Eastern Prehistoric Force 10. Eastern Prehistoric Force 2 pts. 9,603
  1. Avatar for rabamino12358 91. rabamino12358 Lv 1 1 pt. 9,254
  2. Avatar for Altercomp 92. Altercomp Lv 1 1 pt. 9,254
  3. Avatar for tokens 93. tokens Lv 1 1 pt. 9,250
  4. Avatar for rezaefar 94. rezaefar Lv 1 1 pt. 9,241
  5. Avatar for Vincera 95. Vincera Lv 1 1 pt. 9,239
  6. Avatar for senor pit 96. senor pit Lv 1 1 pt. 9,234
  7. Avatar for andrewxc 97. andrewxc Lv 1 1 pt. 9,233
  8. Avatar for Flagg65a 98. Flagg65a Lv 1 1 pt. 9,219
  9. Avatar for martinf 99. martinf Lv 1 1 pt. 9,213
  10. Avatar for Auntecedent 100. Auntecedent Lv 1 1 pt. 9,208

Comments