Placeholder image of a protein
Icon representing a puzzle

1486: Revisiting Puzzle 165: Rosetta Model 15

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 20, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The starting structure is a Rosetta model. This protein contains four cysteine residues, but only two of them oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 9,254
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 9,094
  3. Avatar for Czech National Team 13. Czech National Team 1 pt. 9,048
  4. Avatar for Richard Dawkins Foundation 14. Richard Dawkins Foundation 1 pt. 9,030
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,990
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 8,833
  1. Avatar for gstelle 121. gstelle Lv 1 1 pt. 9,021
  2. Avatar for momadoc 122. momadoc Lv 1 1 pt. 8,993
  3. Avatar for ghiggins 123. ghiggins Lv 1 1 pt. 8,990
  4. Avatar for NotJim99 124. NotJim99 Lv 1 1 pt. 8,990
  5. Avatar for alyssa_d 125. alyssa_d Lv 1 1 pt. 8,978
  6. Avatar for xultai 126. xultai Lv 1 1 pt. 8,976
  7. Avatar for Joe221 127. Joe221 Lv 1 1 pt. 8,965
  8. Avatar for elpeleq42 128. elpeleq42 Lv 1 1 pt. 8,959
  9. Avatar for lamba2013 129. lamba2013 Lv 1 1 pt. 8,936
  10. Avatar for sboy171772 130. sboy171772 Lv 1 1 pt. 8,897

Comments