Placeholder image of a protein
Icon representing a puzzle

1486: Revisiting Puzzle 165: Rosetta Model 15

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 20, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The starting structure is a Rosetta model. This protein contains four cysteine residues, but only two of them oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,202
  2. Avatar for Go Science 2. Go Science 71 pts. 10,115
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 10,077
  4. Avatar for Marvin's bunch 4. Marvin's bunch 33 pts. 10,015
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 9,953
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 14 pts. 9,949
  7. Avatar for HMT heritage 7. HMT heritage 8 pts. 9,872
  8. Avatar for Contenders 8. Contenders 5 pts. 9,796
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 3 pts. 9,795
  10. Avatar for Eastern Prehistoric Force 10. Eastern Prehistoric Force 2 pts. 9,603
  1. Avatar for gstelle 121. gstelle Lv 1 1 pt. 9,021
  2. Avatar for momadoc 122. momadoc Lv 1 1 pt. 8,993
  3. Avatar for ghiggins 123. ghiggins Lv 1 1 pt. 8,990
  4. Avatar for NotJim99 124. NotJim99 Lv 1 1 pt. 8,990
  5. Avatar for alyssa_d 125. alyssa_d Lv 1 1 pt. 8,978
  6. Avatar for xultai 126. xultai Lv 1 1 pt. 8,976
  7. Avatar for Joe221 127. Joe221 Lv 1 1 pt. 8,965
  8. Avatar for elpeleq42 128. elpeleq42 Lv 1 1 pt. 8,959
  9. Avatar for lamba2013 129. lamba2013 Lv 1 1 pt. 8,936
  10. Avatar for sboy171772 130. sboy171772 Lv 1 1 pt. 8,897

Comments