Placeholder image of a protein
Icon representing a puzzle

1486: Revisiting Puzzle 165: Rosetta Model 15

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 20, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The starting structure is a Rosetta model. This protein contains four cysteine residues, but only two of them oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 9,254
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 9,094
  3. Avatar for Czech National Team 13. Czech National Team 1 pt. 9,048
  4. Avatar for Richard Dawkins Foundation 14. Richard Dawkins Foundation 1 pt. 9,030
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,990
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 8,833
  1. Avatar for johnmitch 21. johnmitch Lv 1 49 pts. 9,843
  2. Avatar for drjr 22. drjr Lv 1 47 pts. 9,831
  3. Avatar for smilingone 23. smilingone Lv 1 45 pts. 9,811
  4. Avatar for YeshuaLives 24. YeshuaLives Lv 1 43 pts. 9,811
  5. Avatar for Sporeo 25. Sporeo Lv 1 42 pts. 9,806
  6. Avatar for Idiotboy 26. Idiotboy Lv 1 40 pts. 9,805
  7. Avatar for altejoh 27. altejoh Lv 1 39 pts. 9,805
  8. Avatar for NinjaGreg 28. NinjaGreg Lv 1 37 pts. 9,798
  9. Avatar for pvc78 29. pvc78 Lv 1 36 pts. 9,798
  10. Avatar for Bletchley Park 30. Bletchley Park Lv 1 34 pts. 9,796

Comments