1486: Revisiting Puzzle 165: Rosetta Model 15

Closed since about 8 years ago

Summary

• Created: February 20, 2018
• Expires: February 28, 2018 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The starting structure is a Rosetta model. This protein contains four cysteine residues, but only two of them oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

• 1. Beta Folders 100 pts. 10,202
• 2. Go Science 71 pts. 10,115
• 3. Gargleblasters 49 pts. 10,077
• 4. Marvin's bunch 33 pts. 10,015
• 5. Void Crushers 22 pts. 9,953
• 6. Anthropic Dreams 14 pts. 9,949
• 7. HMT heritage 8 pts. 9,872
• 8. Contenders 5 pts. 9,796
• 9. L'Alliance Francophone 3 pts. 9,795
• 10. Eastern Prehistoric Force 2 pts. 9,603

Top soloists

• 21. johnmitch 49 pts. 9,843
• 22. drjr 47 pts. 9,831
• 23. smilingone 45 pts. 9,811
• 24. YeshuaLives 43 pts. 9,811
• 25. Sporeo 42 pts. 9,806
• 26. Idiotboy 40 pts. 9,805
• 27. altejoh 39 pts. 9,805
• 28. NinjaGreg 37 pts. 9,798
• 29. pvc78 36 pts. 9,798
• 30. Bletchley Park 34 pts. 9,796