Placeholder image of a protein
Icon representing a puzzle

1486: Revisiting Puzzle 165: Rosetta Model 15

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 20, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The starting structure is a Rosetta model. This protein contains four cysteine residues, but only two of them oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 9,254
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 9,094
  3. Avatar for Czech National Team 13. Czech National Team 1 pt. 9,048
  4. Avatar for Richard Dawkins Foundation 14. Richard Dawkins Foundation 1 pt. 9,030
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,990
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 8,833
  1. Avatar for diamonddays 51. diamonddays Lv 1 13 pts. 9,701
  2. Avatar for weitzen 52. weitzen Lv 1 13 pts. 9,695
  3. Avatar for DoctorSockrates 53. DoctorSockrates Lv 1 12 pts. 9,695
  4. Avatar for guineapig 54. guineapig Lv 1 11 pts. 9,675
  5. Avatar for Vinara 55. Vinara Lv 1 11 pts. 9,671
  6. Avatar for katling 56. katling Lv 1 10 pts. 9,670
  7. Avatar for froggs554 57. froggs554 Lv 1 10 pts. 9,669
  8. Avatar for Museka 58. Museka Lv 1 9 pts. 9,662
  9. Avatar for alcor29 59. alcor29 Lv 1 9 pts. 9,656
  10. Avatar for kyky 60. kyky Lv 1 8 pts. 9,643

Comments