Placeholder image of a protein
Icon representing a puzzle

1486: Revisiting Puzzle 165: Rosetta Model 15

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 20, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The starting structure is a Rosetta model. This protein contains four cysteine residues, but only two of them oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,202
  2. Avatar for Go Science 2. Go Science 71 pts. 10,115
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 10,077
  4. Avatar for Marvin's bunch 4. Marvin's bunch 33 pts. 10,015
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 9,953
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 14 pts. 9,949
  7. Avatar for HMT heritage 7. HMT heritage 8 pts. 9,872
  8. Avatar for Contenders 8. Contenders 5 pts. 9,796
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 3 pts. 9,795
  10. Avatar for Eastern Prehistoric Force 10. Eastern Prehistoric Force 2 pts. 9,603
  1. Avatar for diamonddays 51. diamonddays Lv 1 13 pts. 9,701
  2. Avatar for weitzen 52. weitzen Lv 1 13 pts. 9,695
  3. Avatar for DoctorSockrates 53. DoctorSockrates Lv 1 12 pts. 9,695
  4. Avatar for guineapig 54. guineapig Lv 1 11 pts. 9,675
  5. Avatar for Vinara 55. Vinara Lv 1 11 pts. 9,671
  6. Avatar for katling 56. katling Lv 1 10 pts. 9,670
  7. Avatar for froggs554 57. froggs554 Lv 1 10 pts. 9,669
  8. Avatar for Museka 58. Museka Lv 1 9 pts. 9,662
  9. Avatar for alcor29 59. alcor29 Lv 1 9 pts. 9,656
  10. Avatar for kyky 60. kyky Lv 1 8 pts. 9,643

Comments