Placeholder image of a protein
Icon representing a puzzle

1486: Revisiting Puzzle 165: Rosetta Model 15

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 20, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The starting structure is a Rosetta model. This protein contains four cysteine residues, but only two of them oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 9,254
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 9,094
  3. Avatar for Czech National Team 13. Czech National Team 1 pt. 9,048
  4. Avatar for Richard Dawkins Foundation 14. Richard Dawkins Foundation 1 pt. 9,030
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,990
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 8,833
  1. Avatar for jermainiac 61. jermainiac Lv 1 8 pts. 9,633
  2. Avatar for ManVsYard 62. ManVsYard Lv 1 8 pts. 9,627
  3. Avatar for Deleted player 63. Deleted player pts. 9,612
  4. Avatar for wuhongzei 64. wuhongzei Lv 1 7 pts. 9,603
  5. Avatar for Anfinsen_slept_here 65. Anfinsen_slept_here Lv 1 6 pts. 9,598
  6. Avatar for Maerlyn138 66. Maerlyn138 Lv 1 6 pts. 9,593
  7. Avatar for isaksson 67. isaksson Lv 1 6 pts. 9,587
  8. Avatar for atlas100 68. atlas100 Lv 1 5 pts. 9,570
  9. Avatar for DAMilwaukeeWisconsin 69. DAMilwaukeeWisconsin Lv 1 5 pts. 9,568
  10. Avatar for Glen B 70. Glen B Lv 1 5 pts. 9,561

Comments