Placeholder image of a protein
Icon representing a puzzle

1486: Revisiting Puzzle 165: Rosetta Model 15

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 20, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The starting structure is a Rosetta model. This protein contains four cysteine residues, but only two of them oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,202
  2. Avatar for Go Science 2. Go Science 71 pts. 10,115
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 10,077
  4. Avatar for Marvin's bunch 4. Marvin's bunch 33 pts. 10,015
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 9,953
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 14 pts. 9,949
  7. Avatar for HMT heritage 7. HMT heritage 8 pts. 9,872
  8. Avatar for Contenders 8. Contenders 5 pts. 9,796
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 3 pts. 9,795
  10. Avatar for Eastern Prehistoric Force 10. Eastern Prehistoric Force 2 pts. 9,603
  1. Avatar for jermainiac 61. jermainiac Lv 1 8 pts. 9,633
  2. Avatar for ManVsYard 62. ManVsYard Lv 1 8 pts. 9,627
  3. Avatar for Deleted player 63. Deleted player pts. 9,612
  4. Avatar for wuhongzei 64. wuhongzei Lv 1 7 pts. 9,603
  5. Avatar for Anfinsen_slept_here 65. Anfinsen_slept_here Lv 1 6 pts. 9,598
  6. Avatar for Maerlyn138 66. Maerlyn138 Lv 1 6 pts. 9,593
  7. Avatar for isaksson 67. isaksson Lv 1 6 pts. 9,587
  8. Avatar for atlas100 68. atlas100 Lv 1 5 pts. 9,570
  9. Avatar for DAMilwaukeeWisconsin 69. DAMilwaukeeWisconsin Lv 1 5 pts. 9,568
  10. Avatar for Glen B 70. Glen B Lv 1 5 pts. 9,561

Comments