Placeholder image of a protein
Icon representing a puzzle

1486: Revisiting Puzzle 165: Rosetta Model 15

Closed since about 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
February 20, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The starting structure is a Rosetta model. This protein contains four cysteine residues, but only two of them oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 9,254
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 9,094
  3. Avatar for Czech National Team 13. Czech National Team 1 pt. 9,048
  4. Avatar for Richard Dawkins Foundation 14. Richard Dawkins Foundation 1 pt. 9,030
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,990
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 8,833
  1. Avatar for Alistair69 81. Alistair69 Lv 1 3 pts. 9,423
  2. Avatar for Deleted player 82. Deleted player pts. 9,413
  3. Avatar for SaraL 83. SaraL Lv 1 2 pts. 9,401
  4. Avatar for xabxs 84. xabxs Lv 1 2 pts. 9,400
  5. Avatar for ppp6 85. ppp6 Lv 1 2 pts. 9,376
  6. Avatar for harvardman 86. harvardman Lv 1 2 pts. 9,363
  7. Avatar for benrh 87. benrh Lv 1 2 pts. 9,319
  8. Avatar for mitarcher 88. mitarcher Lv 1 2 pts. 9,292
  9. Avatar for hada 89. hada Lv 1 2 pts. 9,287
  10. Avatar for marsfan 90. marsfan Lv 1 2 pts. 9,263

Comments