Placeholder image of a protein
Icon representing a puzzle

1486: Revisiting Puzzle 165: Rosetta Model 15

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 20, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The starting structure is a Rosetta model. This protein contains four cysteine residues, but only two of them oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,202
  2. Avatar for Go Science 2. Go Science 71 pts. 10,115
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 10,077
  4. Avatar for Marvin's bunch 4. Marvin's bunch 33 pts. 10,015
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 9,953
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 14 pts. 9,949
  7. Avatar for HMT heritage 7. HMT heritage 8 pts. 9,872
  8. Avatar for Contenders 8. Contenders 5 pts. 9,796
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 3 pts. 9,795
  10. Avatar for Eastern Prehistoric Force 10. Eastern Prehistoric Force 2 pts. 9,603
  1. Avatar for Alistair69 81. Alistair69 Lv 1 3 pts. 9,423
  2. Avatar for Deleted player 82. Deleted player pts. 9,413
  3. Avatar for SaraL 83. SaraL Lv 1 2 pts. 9,401
  4. Avatar for xabxs 84. xabxs Lv 1 2 pts. 9,400
  5. Avatar for ppp6 85. ppp6 Lv 1 2 pts. 9,376
  6. Avatar for harvardman 86. harvardman Lv 1 2 pts. 9,363
  7. Avatar for benrh 87. benrh Lv 1 2 pts. 9,319
  8. Avatar for mitarcher 88. mitarcher Lv 1 2 pts. 9,292
  9. Avatar for hada 89. hada Lv 1 2 pts. 9,287
  10. Avatar for marsfan 90. marsfan Lv 1 2 pts. 9,263

Comments