Placeholder image of a protein
Icon representing a puzzle

1487: Unsolved De-novo Freestyle 127

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 22, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


KLRIRIDGVNIEIENMDDKFRKGEDEIHVDIDGIHLHLENGRWEIRVDGRHVEIRNGNMEDMRQGKDRSTITVDGHEVEMT

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 5,622
  2. Avatar for HMT heritage 12. HMT heritage 1 pt. 5,060
  3. Avatar for Russian team 13. Russian team 1 pt. 0
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 0
  1. Avatar for Perhonen 121. Perhonen Lv 1 1 pt. 6,261
  2. Avatar for BillBillsonson 122. BillBillsonson Lv 1 1 pt. 6,250
  3. Avatar for sktbrd341 123. sktbrd341 Lv 1 1 pt. 6,239
  4. Avatar for kyky 124. kyky Lv 1 1 pt. 6,158
  5. Avatar for DAMilwaukeeWisconsin 125. DAMilwaukeeWisconsin Lv 1 1 pt. 6,115
  6. Avatar for Sporeo 126. Sporeo Lv 1 1 pt. 5,846
  7. Avatar for Threeoak 127. Threeoak Lv 1 1 pt. 5,721
  8. Avatar for xabxs 128. xabxs Lv 1 1 pt. 5,656
  9. Avatar for alyssa_d 129. alyssa_d Lv 1 1 pt. 5,622
  10. Avatar for altejoh 130. altejoh Lv 1 1 pt. 5,556

Comments