Placeholder image of a protein
Icon representing a puzzle

1487: Unsolved De-novo Freestyle 127

Closed since about 8 years ago

Intermediate Overall Prediction

Summary


Created
February 22, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


KLRIRIDGVNIEIENMDDKFRKGEDEIHVDIDGIHLHLENGRWEIRVDGRHVEIRNGNMEDMRQGKDRSTITVDGHEVEMT

Top groups


  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 5,622
  2. Avatar for HMT heritage 12. HMT heritage 1 pt. 5,060
  3. Avatar for Russian team 13. Russian team 1 pt. 0
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 0

  1. Avatar for jobo0502 51. jobo0502 Lv 1 14 pts. 8,620
  2. Avatar for johnmitch 52. johnmitch Lv 1 14 pts. 8,596
  3. Avatar for @lison 53. @lison Lv 1 13 pts. 8,590
  4. Avatar for toshiue 54. toshiue Lv 1 12 pts. 8,568
  5. Avatar for rabamino12358 55. rabamino12358 Lv 1 12 pts. 8,557
  6. Avatar for arcsign 56. arcsign Lv 1 11 pts. 8,547
  7. Avatar for Maerlyn138 57. Maerlyn138 Lv 1 11 pts. 8,528
  8. Avatar for silent gene 58. silent gene Lv 1 10 pts. 8,524
  9. Avatar for YGK 59. YGK Lv 1 10 pts. 8,520
  10. Avatar for Deleted player 60. Deleted player pts. 8,513

Comments