Placeholder image of a protein
Icon representing a puzzle

1487: Unsolved De-novo Freestyle 127

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 22, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


KLRIRIDGVNIEIENMDDKFRKGEDEIHVDIDGIHLHLENGRWEIRVDGRHVEIRNGNMEDMRQGKDRSTITVDGHEVEMT

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 5,622
  2. Avatar for HMT heritage 12. HMT heritage 1 pt. 5,060
  3. Avatar for Russian team 13. Russian team 1 pt. 0
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 0
  1. Avatar for rezaefar 81. rezaefar Lv 1 3 pts. 7,993
  2. Avatar for SouperGenious 82. SouperGenious Lv 1 3 pts. 7,940
  3. Avatar for Superphosphate 83. Superphosphate Lv 1 3 pts. 7,933
  4. Avatar for abiogenesis 84. abiogenesis Lv 1 3 pts. 7,929
  5. Avatar for pfirth 85. pfirth Lv 1 2 pts. 7,907
  6. Avatar for sciencewalker 86. sciencewalker Lv 1 2 pts. 7,902
  7. Avatar for RainerGewalt 87. RainerGewalt Lv 1 2 pts. 7,888
  8. Avatar for SaintNick 88. SaintNick Lv 1 2 pts. 7,859
  9. Avatar for pfeiffelfloyd 89. pfeiffelfloyd Lv 1 2 pts. 7,829
  10. Avatar for SWR_DMaster 90. SWR_DMaster Lv 1 2 pts. 7,823

Comments