Placeholder image of a protein
Icon representing a puzzle

1489: Revisiting Puzzle 52: Bacteria Energy

Closed since about 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
February 28, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 9,069
  2. Avatar for Russian team 12. Russian team 1 pt. 9,067
  3. Avatar for Alpha Rays 13. Alpha Rays 1 pt. 8,986
  4. Avatar for Richard Dawkins Foundation 14. Richard Dawkins Foundation 1 pt. 8,962
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,834
  6. Avatar for Eastern Prehistoric Force 16. Eastern Prehistoric Force 1 pt. 8,801
  1. Avatar for Blipperman 51. Blipperman Lv 1 15 pts. 9,348
  2. Avatar for georg137 52. georg137 Lv 1 15 pts. 9,346
  3. Avatar for diamonddays 53. diamonddays Lv 1 14 pts. 9,345
  4. Avatar for alcor29 54. alcor29 Lv 1 13 pts. 9,345
  5. Avatar for jausmh 55. jausmh Lv 1 13 pts. 9,338
  6. Avatar for robgee 56. robgee Lv 1 12 pts. 9,324
  7. Avatar for katling 57. katling Lv 1 12 pts. 9,318
  8. Avatar for Merf 58. Merf Lv 1 11 pts. 9,295
  9. Avatar for froggs554 59. froggs554 Lv 1 11 pts. 9,272
  10. Avatar for Deleted player 60. Deleted player pts. 9,269

Comments