Placeholder image of a protein
Icon representing a puzzle

1489: Revisiting Puzzle 52: Bacteria Energy

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 28, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,865
  2. Avatar for Beta Folders 2. Beta Folders 71 pts. 9,848
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 9,820
  4. Avatar for Marvin's bunch 4. Marvin's bunch 33 pts. 9,778
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 9,706
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 14 pts. 9,703
  7. Avatar for Contenders 7. Contenders 8 pts. 9,636
  8. Avatar for HMT heritage 8. HMT heritage 5 pts. 9,613
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 3 pts. 9,587
  10. Avatar for DSN @ Home 10. DSN @ Home 2 pts. 9,181
  1. Avatar for Blipperman 51. Blipperman Lv 1 15 pts. 9,348
  2. Avatar for georg137 52. georg137 Lv 1 15 pts. 9,346
  3. Avatar for diamonddays 53. diamonddays Lv 1 14 pts. 9,345
  4. Avatar for alcor29 54. alcor29 Lv 1 13 pts. 9,345
  5. Avatar for jausmh 55. jausmh Lv 1 13 pts. 9,338
  6. Avatar for robgee 56. robgee Lv 1 12 pts. 9,324
  7. Avatar for katling 57. katling Lv 1 12 pts. 9,318
  8. Avatar for Merf 58. Merf Lv 1 11 pts. 9,295
  9. Avatar for froggs554 59. froggs554 Lv 1 11 pts. 9,272
  10. Avatar for Deleted player 60. Deleted player pts. 9,269

Comments