Placeholder image of a protein
Icon representing a puzzle

1495: Revisiting Puzzle 55: Scorpion Toxin

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
March 13, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,707
  2. Avatar for Go Science 2. Go Science 74 pts. 10,647
  3. Avatar for Void Crushers 3. Void Crushers 54 pts. 10,603
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 10,542
  5. Avatar for Gargleblasters 5. Gargleblasters 27 pts. 10,430
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 18 pts. 10,347
  7. Avatar for Contenders 7. Contenders 12 pts. 10,335
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 8 pts. 10,317
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 10,156
  10. Avatar for Deleted group 10. Deleted group pts. 9,146
  1. Avatar for jeff101 41. jeff101 Lv 1 25 pts. 9,853
  2. Avatar for jausmh 42. jausmh Lv 1 24 pts. 9,845
  3. Avatar for WBarme1234 43. WBarme1234 Lv 1 23 pts. 9,801
  4. Avatar for diamonddays 44. diamonddays Lv 1 22 pts. 9,784
  5. Avatar for tarimo 45. tarimo Lv 1 21 pts. 9,783
  6. Avatar for dbuske 46. dbuske Lv 1 20 pts. 9,766
  7. Avatar for Deleted player 47. Deleted player pts. 9,756
  8. Avatar for alwen 48. alwen Lv 1 19 pts. 9,730
  9. Avatar for cobaltteal 49. cobaltteal Lv 1 18 pts. 9,709
  10. Avatar for TastyMunchies 50. TastyMunchies Lv 1 17 pts. 9,676

Comments