Placeholder image of a protein
Icon representing a puzzle

1495: Revisiting Puzzle 55: Scorpion Toxin

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
March 13, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,707
  2. Avatar for Go Science 2. Go Science 74 pts. 10,647
  3. Avatar for Void Crushers 3. Void Crushers 54 pts. 10,603
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 10,542
  5. Avatar for Gargleblasters 5. Gargleblasters 27 pts. 10,430
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 18 pts. 10,347
  7. Avatar for Contenders 7. Contenders 12 pts. 10,335
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 8 pts. 10,317
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 10,156
  10. Avatar for Deleted group 10. Deleted group pts. 9,146
  1. Avatar for katling 51. katling Lv 1 16 pts. 9,652
  2. Avatar for TheGUmmer 52. TheGUmmer Lv 1 16 pts. 9,649
  3. Avatar for Fat Tony 53. Fat Tony Lv 1 15 pts. 9,648
  4. Avatar for fishercat 54. fishercat Lv 1 14 pts. 9,630
  5. Avatar for froggs554 55. froggs554 Lv 1 14 pts. 9,590
  6. Avatar for heather-1 56. heather-1 Lv 1 13 pts. 9,537
  7. Avatar for alcor29 57. alcor29 Lv 1 12 pts. 9,514
  8. Avatar for ourtown 58. ourtown Lv 1 12 pts. 9,495
  9. Avatar for Vincera 59. Vincera Lv 1 11 pts. 9,487
  10. Avatar for manu8170 60. manu8170 Lv 1 11 pts. 9,462

Comments