Placeholder image of a protein
Icon representing a puzzle

1498: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since about 8 years ago

Intermediate Overall Prediction

Summary


Created
March 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups


  1. Avatar for freefolder 11. freefolder 1 pt. 8,460
  2. Avatar for Deleted group 12. Deleted group pts. 8,396
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 8,373
  4. Avatar for foldeRNA 14. foldeRNA 1 pt. 8,350
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,272
  6. Avatar for Window Group 16. Window Group 1 pt. 0
  7. Avatar for test_group1 17. test_group1 1 pt. 0

  1. Avatar for andromeda72 101. andromeda72 Lv 1 1 pt. 8,373
  2. Avatar for Psych0Active 102. Psych0Active Lv 1 1 pt. 8,371
  3. Avatar for silent gene 103. silent gene Lv 1 1 pt. 8,360
  4. Avatar for JeNNeR 104. JeNNeR Lv 1 1 pt. 8,350
  5. Avatar for cinnamonkitty 105. cinnamonkitty Lv 1 1 pt. 8,309
  6. Avatar for SaraL 106. SaraL Lv 1 1 pt. 8,306
  7. Avatar for rinze 107. rinze Lv 1 1 pt. 8,293
  8. Avatar for Museka 108. Museka Lv 1 1 pt. 8,292
  9. Avatar for multaq 109. multaq Lv 1 1 pt. 8,290
  10. Avatar for alyssa_d 110. alyssa_d Lv 1 1 pt. 8,272

Comments