Placeholder image of a protein
Icon representing a puzzle

1498: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
March 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 10,558
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 10,510
  3. Avatar for Void Crushers 3. Void Crushers 52 pts. 10,508
  4. Avatar for Beta Folders 4. Beta Folders 36 pts. 10,454
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 24 pts. 10,417
  6. Avatar for Marvin's bunch 6. Marvin's bunch 16 pts. 10,361
  7. Avatar for Go Science 7. Go Science 10 pts. 10,342
  8. Avatar for Contenders 8. Contenders 6 pts. 10,246
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 9,860
  10. Avatar for Russian team 10. Russian team 2 pts. 9,398
  1. Avatar for andromeda72 101. andromeda72 Lv 1 1 pt. 8,373
  2. Avatar for Psych0Active 102. Psych0Active Lv 1 1 pt. 8,371
  3. Avatar for silent gene 103. silent gene Lv 1 1 pt. 8,360
  4. Avatar for JeNNeR 104. JeNNeR Lv 1 1 pt. 8,350
  5. Avatar for cinnamonkitty 105. cinnamonkitty Lv 1 1 pt. 8,309
  6. Avatar for SaraL 106. SaraL Lv 1 1 pt. 8,306
  7. Avatar for rinze 107. rinze Lv 1 1 pt. 8,293
  8. Avatar for Museka 108. Museka Lv 1 1 pt. 8,292
  9. Avatar for multaq 109. multaq Lv 1 1 pt. 8,290
  10. Avatar for alyssa_d 110. alyssa_d Lv 1 1 pt. 8,272

Comments