Placeholder image of a protein
Icon representing a puzzle

1498: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since about 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
March 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 8,460
  2. Avatar for Deleted group 12. Deleted group pts. 8,396
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 8,373
  4. Avatar for foldeRNA 14. foldeRNA 1 pt. 8,350
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,272
  6. Avatar for Window Group 16. Window Group 1 pt. 0
  7. Avatar for test_group1 17. test_group1 1 pt. 0
  1. Avatar for abiogenesis 121. abiogenesis Lv 1 1 pt. 7,939
  2. Avatar for brow42 122. brow42 Lv 1 1 pt. 7,912
  3. Avatar for larry25427 123. larry25427 Lv 1 1 pt. 7,759
  4. Avatar for Adam99 124. Adam99 Lv 1 1 pt. 7,758
  5. Avatar for danq 125. danq Lv 1 1 pt. 7,710
  6. Avatar for emdee314 126. emdee314 Lv 1 1 pt. 7,604
  7. Avatar for doranp02 127. doranp02 Lv 1 1 pt. 7,392
  8. Avatar for 01010011111 128. 01010011111 Lv 1 1 pt. 7,360
  9. Avatar for west.elsdon 129. west.elsdon Lv 1 1 pt. 7,327
  10. Avatar for altejoh 130. altejoh Lv 1 1 pt. 7,050

Comments