Placeholder image of a protein
Icon representing a puzzle

1498: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
March 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 10,558
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 10,510
  3. Avatar for Void Crushers 3. Void Crushers 52 pts. 10,508
  4. Avatar for Beta Folders 4. Beta Folders 36 pts. 10,454
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 24 pts. 10,417
  6. Avatar for Marvin's bunch 6. Marvin's bunch 16 pts. 10,361
  7. Avatar for Go Science 7. Go Science 10 pts. 10,342
  8. Avatar for Contenders 8. Contenders 6 pts. 10,246
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 9,860
  10. Avatar for Russian team 10. Russian team 2 pts. 9,398
  1. Avatar for abiogenesis 121. abiogenesis Lv 1 1 pt. 7,939
  2. Avatar for brow42 122. brow42 Lv 1 1 pt. 7,912
  3. Avatar for larry25427 123. larry25427 Lv 1 1 pt. 7,759
  4. Avatar for Adam99 124. Adam99 Lv 1 1 pt. 7,758
  5. Avatar for danq 125. danq Lv 1 1 pt. 7,710
  6. Avatar for emdee314 126. emdee314 Lv 1 1 pt. 7,604
  7. Avatar for doranp02 127. doranp02 Lv 1 1 pt. 7,392
  8. Avatar for 01010011111 128. 01010011111 Lv 1 1 pt. 7,360
  9. Avatar for west.elsdon 129. west.elsdon Lv 1 1 pt. 7,327
  10. Avatar for altejoh 130. altejoh Lv 1 1 pt. 7,050

Comments