Placeholder image of a protein
Icon representing a puzzle

1498: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
March 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 8,460
  2. Avatar for Deleted group 12. Deleted group pts. 8,396
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 8,373
  4. Avatar for foldeRNA 14. foldeRNA 1 pt. 8,350
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,272
  6. Avatar for Window Group 16. Window Group 1 pt. 0
  7. Avatar for test_group1 17. test_group1 1 pt. 0
  1. Avatar for 118problems 131. 118problems Lv 1 1 pt. 6,602
  2. Avatar for Tehnologik1 132. Tehnologik1 Lv 1 1 pt. 6,498
  3. Avatar for Keresto 133. Keresto Lv 1 1 pt. 5,761
  4. Avatar for Helioos 134. Helioos Lv 1 1 pt. 1,279
  5. Avatar for Uttkarsh 135. Uttkarsh Lv 1 1 pt. 0
  6. Avatar for hpaege 136. hpaege Lv 1 1 pt. 0
  7. Avatar for Neil9 137. Neil9 Lv 1 1 pt. 0
  8. Avatar for pietro.willi 138. pietro.willi Lv 1 1 pt. 0
  9. Avatar for jflat06 139. jflat06 Lv 1 1 pt. 0
  10. Avatar for test_account2 140. test_account2 Lv 1 1 pt. 0

Comments