Placeholder image of a protein
Icon representing a puzzle

1498: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
March 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 10,558
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 10,510
  3. Avatar for Void Crushers 3. Void Crushers 52 pts. 10,508
  4. Avatar for Beta Folders 4. Beta Folders 36 pts. 10,454
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 24 pts. 10,417
  6. Avatar for Marvin's bunch 6. Marvin's bunch 16 pts. 10,361
  7. Avatar for Go Science 7. Go Science 10 pts. 10,342
  8. Avatar for Contenders 8. Contenders 6 pts. 10,246
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 9,860
  10. Avatar for Russian team 10. Russian team 2 pts. 9,398
  1. Avatar for 118problems 131. 118problems Lv 1 1 pt. 6,602
  2. Avatar for Tehnologik1 132. Tehnologik1 Lv 1 1 pt. 6,498
  3. Avatar for Keresto 133. Keresto Lv 1 1 pt. 5,761
  4. Avatar for Helioos 134. Helioos Lv 1 1 pt. 1,279
  5. Avatar for Uttkarsh 135. Uttkarsh Lv 1 1 pt. 0
  6. Avatar for hpaege 136. hpaege Lv 1 1 pt. 0
  7. Avatar for Neil9 137. Neil9 Lv 1 1 pt. 0
  8. Avatar for pietro.willi 138. pietro.willi Lv 1 1 pt. 0
  9. Avatar for jflat06 139. jflat06 Lv 1 1 pt. 0
  10. Avatar for test_account2 140. test_account2 Lv 1 1 pt. 0

Comments