Placeholder image of a protein
Icon representing a puzzle

1498: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since about 8 years ago

Intermediate Overall Prediction

Summary


Created
March 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups


  1. Avatar for freefolder 11. freefolder 1 pt. 8,460
  2. Avatar for Deleted group 12. Deleted group pts. 8,396
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 8,373
  4. Avatar for foldeRNA 14. foldeRNA 1 pt. 8,350
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,272
  6. Avatar for Window Group 16. Window Group 1 pt. 0
  7. Avatar for test_group1 17. test_group1 1 pt. 0

  1. Avatar for georg137 21. georg137 Lv 1 46 pts. 10,246
  2. Avatar for Deleted player 22. Deleted player pts. 10,244
  3. Avatar for ZeroLeak7 23. ZeroLeak7 Lv 1 43 pts. 10,212
  4. Avatar for dizzywings 24. dizzywings Lv 1 41 pts. 10,198
  5. Avatar for Bletchley Park 25. Bletchley Park Lv 1 39 pts. 10,153
  6. Avatar for guineapig 26. guineapig Lv 1 38 pts. 10,151
  7. Avatar for Vinara 27. Vinara Lv 1 36 pts. 10,109
  8. Avatar for Anfinsen_slept_here 28. Anfinsen_slept_here Lv 1 34 pts. 10,081
  9. Avatar for Idiotboy 29. Idiotboy Lv 1 33 pts. 10,075
  10. Avatar for tarimo 30. tarimo Lv 1 32 pts. 10,071

Comments