Placeholder image of a protein
Icon representing a puzzle

1498: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
March 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 10,558
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 10,510
  3. Avatar for Void Crushers 3. Void Crushers 52 pts. 10,508
  4. Avatar for Beta Folders 4. Beta Folders 36 pts. 10,454
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 24 pts. 10,417
  6. Avatar for Marvin's bunch 6. Marvin's bunch 16 pts. 10,361
  7. Avatar for Go Science 7. Go Science 10 pts. 10,342
  8. Avatar for Contenders 8. Contenders 6 pts. 10,246
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 9,860
  10. Avatar for Russian team 10. Russian team 2 pts. 9,398
  1. Avatar for georg137 21. georg137 Lv 1 46 pts. 10,246
  2. Avatar for Deleted player 22. Deleted player pts. 10,244
  3. Avatar for ZeroLeak7 23. ZeroLeak7 Lv 1 43 pts. 10,212
  4. Avatar for dizzywings 24. dizzywings Lv 1 41 pts. 10,198
  5. Avatar for Bletchley Park 25. Bletchley Park Lv 1 39 pts. 10,153
  6. Avatar for guineapig 26. guineapig Lv 1 38 pts. 10,151
  7. Avatar for Vinara 27. Vinara Lv 1 36 pts. 10,109
  8. Avatar for Anfinsen_slept_here 28. Anfinsen_slept_here Lv 1 34 pts. 10,081
  9. Avatar for Idiotboy 29. Idiotboy Lv 1 33 pts. 10,075
  10. Avatar for tarimo 30. tarimo Lv 1 32 pts. 10,071

Comments