Placeholder image of a protein
Icon representing a puzzle

1506: Revisiting Puzzle 59: TCR Binding Protein

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
April 09, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 10,157
  2. Avatar for Beta Folders 2. Beta Folders 63 pts. 10,138
  3. Avatar for Go Science 3. Go Science 37 pts. 10,115
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 10,101
  5. Avatar for Void Crushers 5. Void Crushers 11 pts. 9,996
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 5 pts. 9,977
  7. Avatar for Marvin's bunch 7. Marvin's bunch 2 pts. 9,946
  8. Avatar for Contenders 8. Contenders 1 pt. 9,932
  9. Avatar for HMT heritage 9. HMT heritage 1 pt. 9,884
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 1 pt. 9,023
  1. Avatar for vinsi 121. vinsi Lv 1 1 pt. 8,828
  2. Avatar for lamoille 122. lamoille Lv 1 1 pt. 8,826
  3. Avatar for bzipitidoo 123. bzipitidoo Lv 1 1 pt. 8,812
  4. Avatar for lconor 124. lconor Lv 1 1 pt. 8,803
  5. Avatar for Anamfija 125. Anamfija Lv 1 1 pt. 8,756
  6. Avatar for parsnip 126. parsnip Lv 1 1 pt. 8,732
  7. Avatar for anaserra 127. anaserra Lv 1 1 pt. 8,709
  8. Avatar for aspadistra 128. aspadistra Lv 1 1 pt. 8,637
  9. Avatar for martinf 129. martinf Lv 1 1 pt. 8,615
  10. Avatar for jyoshimi 130. jyoshimi Lv 1 1 pt. 8,582

Comments