Placeholder image of a protein
Icon representing a puzzle

1506: Revisiting Puzzle 59: TCR Binding Protein

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
April 09, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 10,157
  2. Avatar for Beta Folders 2. Beta Folders 63 pts. 10,138
  3. Avatar for Go Science 3. Go Science 37 pts. 10,115
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 10,101
  5. Avatar for Void Crushers 5. Void Crushers 11 pts. 9,996
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 5 pts. 9,977
  7. Avatar for Marvin's bunch 7. Marvin's bunch 2 pts. 9,946
  8. Avatar for Contenders 8. Contenders 1 pt. 9,932
  9. Avatar for HMT heritage 9. HMT heritage 1 pt. 9,884
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 1 pt. 9,023
  1. Avatar for Arne Heessels 111. Arne Heessels Lv 1 1 pt. 8,872
  2. Avatar for cherry39 112. cherry39 Lv 1 1 pt. 8,870
  3. Avatar for Savas 113. Savas Lv 1 1 pt. 8,864
  4. Avatar for peanutbutterwithhoney 114. peanutbutterwithhoney Lv 1 1 pt. 8,853
  5. Avatar for alyssa_d 115. alyssa_d Lv 1 1 pt. 8,853
  6. Avatar for momadoc 116. momadoc Lv 1 1 pt. 8,851
  7. Avatar for ManVsYard 117. ManVsYard Lv 1 1 pt. 8,843
  8. Avatar for leehaggis 118. leehaggis Lv 1 1 pt. 8,842
  9. Avatar for HRM Chatzibarbakarapapadopoulos 119. HRM Chatzibarbakarapapadopoulos Lv 1 1 pt. 8,841
  10. Avatar for Bridge Dan.Ols. 120. Bridge Dan.Ols. Lv 1 1 pt. 8,834

Comments