Placeholder image of a protein
Icon representing a puzzle

1508: Revisiting Puzzle 60: Beta Barrel

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
April 15, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 11,220
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 10,921
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 10,694
  4. Avatar for incognito group 14. incognito group 1 pt. 10,571
  1. Avatar for actiasluna 11. actiasluna Lv 1 70 pts. 12,441
  2. Avatar for pvc78 12. pvc78 Lv 1 67 pts. 12,431
  3. Avatar for drjr 13. drjr Lv 1 65 pts. 12,403
  4. Avatar for Idiotboy 14. Idiotboy Lv 1 62 pts. 12,396
  5. Avatar for fiendish_ghoul 15. fiendish_ghoul Lv 1 60 pts. 12,377
  6. Avatar for retiredmichael 16. retiredmichael Lv 1 57 pts. 12,371
  7. Avatar for Skippysk8s 17. Skippysk8s Lv 1 55 pts. 12,328
  8. Avatar for reefyrob 18. reefyrob Lv 1 53 pts. 12,311
  9. Avatar for christioanchauvin 19. christioanchauvin Lv 1 51 pts. 12,307
  10. Avatar for Enzyme 20. Enzyme Lv 1 49 pts. 12,275

Comments