Placeholder image of a protein
Icon representing a puzzle

1508: Revisiting Puzzle 60: Beta Barrel

Closed since about 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 15, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups


  1. Avatar for Beta Folders 100 pts. 12,708
  2. Avatar for Go Science 2. Go Science 68 pts. 12,636
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 44 pts. 12,608
  4. Avatar for Gargleblasters 4. Gargleblasters 27 pts. 12,544
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 12,530
  6. Avatar for Void Crushers 6. Void Crushers 9 pts. 12,449
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 5 pts. 12,307
  8. Avatar for Contenders 8. Contenders 3 pts. 12,257
  9. Avatar for HMT heritage 9. HMT heritage 1 pt. 12,145
  10. Avatar for Team China 10. Team China 1 pt. 11,646

  1. Avatar for actiasluna 11. actiasluna Lv 1 70 pts. 12,441
  2. Avatar for pvc78 12. pvc78 Lv 1 67 pts. 12,431
  3. Avatar for drjr 13. drjr Lv 1 65 pts. 12,403
  4. Avatar for Idiotboy 14. Idiotboy Lv 1 62 pts. 12,396
  5. Avatar for fiendish_ghoul 15. fiendish_ghoul Lv 1 60 pts. 12,377
  6. Avatar for retiredmichael 16. retiredmichael Lv 1 57 pts. 12,371
  7. Avatar for Skippysk8s 17. Skippysk8s Lv 1 55 pts. 12,328
  8. Avatar for reefyrob 18. reefyrob Lv 1 53 pts. 12,311
  9. Avatar for christioanchauvin 19. christioanchauvin Lv 1 51 pts. 12,307
  10. Avatar for Enzyme 20. Enzyme Lv 1 49 pts. 12,275

Comments