Placeholder image of a protein
Icon representing a puzzle

1508: Revisiting Puzzle 60: Beta Barrel

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
April 15, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 12,708
  2. Avatar for Go Science 2. Go Science 68 pts. 12,636
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 44 pts. 12,608
  4. Avatar for Gargleblasters 4. Gargleblasters 27 pts. 12,544
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 12,530
  6. Avatar for Void Crushers 6. Void Crushers 9 pts. 12,449
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 5 pts. 12,307
  8. Avatar for Contenders 8. Contenders 3 pts. 12,257
  9. Avatar for HMT heritage 9. HMT heritage 1 pt. 12,145
  10. Avatar for Team China 10. Team China 1 pt. 11,646
  1. Avatar for Madde 21. Madde Lv 1 47 pts. 12,268
  2. Avatar for NinjaGreg 22. NinjaGreg Lv 1 45 pts. 12,266
  3. Avatar for Bletchley Park 23. Bletchley Park Lv 1 43 pts. 12,257
  4. Avatar for Galaxie 24. Galaxie Lv 1 42 pts. 12,250
  5. Avatar for dcrwheeler 25. dcrwheeler Lv 1 40 pts. 12,244
  6. Avatar for Threeoak 26. Threeoak Lv 1 38 pts. 12,223
  7. Avatar for johnmitch 27. johnmitch Lv 1 37 pts. 12,203
  8. Avatar for pauldunn 28. pauldunn Lv 1 35 pts. 12,179
  9. Avatar for weitzen 29. weitzen Lv 1 34 pts. 12,158
  10. Avatar for Deleted player 30. Deleted player pts. 12,153

Comments