Placeholder image of a protein
Icon representing a puzzle

1511: Unsolved De-novo Freestyle 129

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
April 20, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


GRQEKVLKSIEETVRKMGVTMETHRSGNEVKVVIKGLHESQQEQLKKDVEETSKKQGVETRIEFHGDTVTIVVRE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,681
  2. Avatar for Beta Folders 2. Beta Folders 65 pts. 10,672
  3. Avatar for Go Science 3. Go Science 41 pts. 10,560
  4. Avatar for Gargleblasters 4. Gargleblasters 24 pts. 10,537
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 14 pts. 10,463
  6. Avatar for Marvin's bunch 6. Marvin's bunch 7 pts. 10,321
  7. Avatar for Void Crushers 7. Void Crushers 4 pts. 10,261
  8. Avatar for Contenders 8. Contenders 2 pts. 9,708
  9. Avatar for Deleted group 9. Deleted group pts. 9,123
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 1 pt. 8,481
  1. Avatar for pauldunn 11. pauldunn Lv 1 66 pts. 10,489
  2. Avatar for actiasluna 12. actiasluna Lv 1 64 pts. 10,485
  3. Avatar for altejoh 13. altejoh Lv 1 61 pts. 10,476
  4. Avatar for christioanchauvin 14. christioanchauvin Lv 1 58 pts. 10,463
  5. Avatar for Bruno Kestemont 15. Bruno Kestemont Lv 1 56 pts. 10,457
  6. Avatar for Deleted player 16. Deleted player pts. 10,404
  7. Avatar for Aubade01 17. Aubade01 Lv 1 51 pts. 10,361
  8. Avatar for Skippysk8s 18. Skippysk8s Lv 1 49 pts. 10,318
  9. Avatar for frood66 19. frood66 Lv 1 46 pts. 10,310
  10. Avatar for Timo van der Laan 20. Timo van der Laan Lv 1 44 pts. 10,261

Comments